SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002718 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002718
Domain Number 1 Region: 206-410
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.16e-41
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 847-1025
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.41e-35
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 445-642
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-35
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 651-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.28e-35
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 5 Region: 1058-1239
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-33
Family Laminin G-like module 0.00000108
Further Details:      
 
Domain Number 6 Region: 25-180
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-30
Family Laminin G-like module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002718   Gene: ENSDORG00000002895   Transcript: ENSDORT00000002895
Sequence length 1541
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1042:19702:974742:1 gene:ENSDORG00000002895 transcript:ENSDORT00000002895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFTFHSVFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVS
TGLLLYLDDGGVCDFLCLSLVDGRVQLRFSMDCAETAMLSNKQVNDSSWHFLMVSRDRLR
TVLVLDGEGQSGELHAQRPYMDVVSDLFLGGVPSDIRPSALTLDGVQAMPGFKGLILDLK
YGNSEPRLLGSQGVQLEAEGPCGERPCENGGICFLLDGHPTCDCSTTGYGGTLCSEGSEG
NSCLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSSDEITLSFKTWQRNGLILHTG
KSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRNLRQVTISVDG
ILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS
RLARIGDTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEP
NGLILFTHGKPQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDG
EWYHVDIQRDGRSGTISVNSRRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWT
AMLNYGYVGCIRDLFIDGRSKNIRQLAEMQNAAGVKSSCSRMSAKQCDSYPCKNNAVCKD
GWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPMVMHTEAEDVSFRFMSQRAYG
LLVATTSRDSADTLRLELDGGRVKLMVNLNCIKINCNSSKGPETLYAGQKLNDNEWHTVR
VVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLVF
NGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFK
TTSADGFILFNSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVIT
RDNSNTHSLKVDTKVVTQVINGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLA
SVDLNGRLPDLINDALHRSGQIERGCEGPSTTCQEDSCANQGVCMQQWEGFTCDCSMTSY
SGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAVGFSTTVKDGILVRIDSAPGL
GDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNATLQVDNWPVN
EHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSV
RLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAEC
SSDDEDFVECEPSTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETSRTTTTSLSPELI
RFTASSSSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRNVP
TANPTEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQV
DETRNYISNSAQSNGTLMKEKQASSKSGHKKQKNKDKEYYV
Download sequence
Identical sequences ENSDORP00000002718 ENSDORP00000002718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]