SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002736 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002736
Domain Number 1 Region: 85-160
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 2.09e-32
Family Skp1 dimerisation domain-like 0.00000653
Further Details:      
 
Domain Number 2 Region: 3-57
Classification Level Classification E-value
Superfamily POZ domain 2.86e-16
Family BTB/POZ domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002736   Gene: ENSDORG00000002912   Transcript: ENSDORT00000002913
Sequence length 163
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1870:1564:11262:-1 gene:ENSDORG00000002912 transcript:ENSDORT00000002913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKXXX
XXXXXXXXXXPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEN
Download sequence
Identical sequences ENSDORP00000002736 ENSDORP00000002736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]