SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002764 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000002764
Domain Number - Region: 46-78
Classification Level Classification E-value
Superfamily F-box domain 0.0425
Family F-box domain 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002764   Gene: ENSDORG00000002941   Transcript: ENSDORT00000002941
Sequence length 106
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_8424:2381:9904:-1 gene:ENSDORG00000002941 transcript:ENSDORT00000002941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGYTPDEKLRLQQLRELRRQWLKDQELSPREPVLPPQKGWPMEEFWKNFVRNGSLWRKL
VYSTYHNTVFAVTRILIPAWIIHYYIKXXXXARPYAIVEKKPRIFP
Download sequence
Identical sequences ENSDORP00000002764 ENSDORP00000002764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]