SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002790 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002790
Domain Number 1 Region: 64-307
Classification Level Classification E-value
Superfamily vWA-like 6.67e-81
Family Integrin A (or I) domain 0.00000033
Further Details:      
 
Domain Number 2 Region: 307-395
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-23
Family Integrin domains 0.0022
Further Details:      
 
Domain Number 3 Region: 559-630
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000379
Family Integrin beta tail domain 0.0078
Further Details:      
 
Domain Number 4 Region: 518-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Integrin beta EGF-like domains 0.0066
Further Details:      
 
Domain Number 5 Region: 475-513
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family Integrin beta EGF-like domains 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002790
Domain Number - Region: 449-477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.019
Family Integrin beta EGF-like domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002790   Gene: ENSDORG00000002970   Transcript: ENSDORT00000002969
Sequence length 713
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_21567:2665:11128:1 gene:ENSDORG00000002970 transcript:ENSDORT00000002969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLARGCPAGELEEPRGRQEVLQDQPLNHGVRGEGATQLAPQRVRLTLRLGEPQQLRVRF
LRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPF
VSTVPSKLRHPCPSRLERCQPPFSFQHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDA
ILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSPE
FDYPSVSQVAQALTEANIQPIFAVTSAALPVYQELSQLIPKSAVGELSEDSSNVVQLIMD
AYDSLSSTVTLEHSSLPQGVDISYKSQCGGPEKGEAGAARGQCTHVRINQTVDFWVTLQA
NNCLPGPHLLRLRALGFSEELIVELHTLCDCNCSDDQPQAPHCSDGQGHLQCGMCSCAPG
RLGRLCECSEAELSSPDLESGCRTPNGTGPLCSGKGRCQCGRCSCSGQSSGRLCECDDAS
CERHEGILCGGFGHCQCGVCHCHANRTGRACECSGDVDRCISSEGKLCSEHGLCKCNRCQ
CLDGYYGVLCDQCPGCRTPCERYRDCAECGAFRTGPLAANCSIACAHTNVTLTLAPILGG
GWCKERTLDKQLFFFLVEEEAGGRAVLTVKLQEKEADHTQTIVLGCIGGIVAVGLGLVLV
YRLLVEIYDRKEYIRFEKEQQQLNWKQDNNPLYQSAITTTVNPNFQGTDGSSL
Download sequence
Identical sequences ENSDORP00000002790 ENSDORP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]