SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002807 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002807
Domain Number 1 Region: 9-270
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.14e-62
Family Eukaryotic proteases 0.00032
Further Details:      
 
Domain Number 2 Region: 294-523
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.13e-50
Family Eukaryotic proteases 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002807   Gene: ENSDORG00000002989   Transcript: ENSDORT00000002987
Sequence length 553
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1326:40976:46375:-1 gene:ENSDORG00000002989 transcript:ENSDORT00000002987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKQSWGPGLLILGAVVLIEGLQAAQRVCGQRGPGPPEPQEGNTVPGEWPWQASVRKQGIH
ICSGSLVAETWVLTAAHCFEKEAATELNSWSVVLGSLQREGLSPGAEEIGVAALQLPQAY
NHYSQGSDLALLLLAHPVARIPLCLPQPAHHFPFGASCWATGWDQDTSNAPRKLRNLRLR
LISRPTCNCLYNRLHQRLLASPARPGMLCGGAQPGVLGPCQGDSGGPVLCQEPNGRWVQV
GIISFASRCAQEDTPVLLTDIAAHSSWLQARAQGAAFLTQAPETRMTSDEDSCVACGSLK
TEGPQAGAPSVWPWDARLKHQGQLACGGALVSEEAVLTAAHCFIGRQTLEEWSVGLGTGS
EEWSLKQLILHGAYTHPEGGYDVALLLLAQPVTLGPTLRPLCLPYADHHLPDGERGWVLG
LARQGAGIGYPQTVPVTVLGPRACGRLHAAPGSDGIPILPGMVCTSVVGERPHCEGLSGA
PLVHEVRGTWFLAGLHSFGDSCQGPARPAVFAALPAYEDWVSSLDWHVYFAEPPEPVVEA
GSCMANSSQPARC
Download sequence
Identical sequences A0A1S3ESR7
ENSDORP00000002807 ENSDORP00000002807 XP_012866974.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]