SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002818 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002818
Domain Number 1 Region: 59-568
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.02e-196
Family Myeloperoxidase-like 0.00000000000000708
Further Details:      
 
Domain Number 2 Region: 19-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000533
Family EGF-type module 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002818   Gene: ENSDORG00000002998   Transcript: ENSDORT00000002999
Sequence length 604
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_11104:20964:26501:-1 gene:ENSDORG00000002998 transcript:ENSDORT00000002999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFARRPLLSAALALCSAANPCCSNPCQNRGECMSVGFDRYSCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPNTVHYILTHFKGVWNIINNIPFLRNSIMKYVLTSRSHLIDSPPTYNVDY
GYKSWEAFSNLSYYTRALPPVADDCPTPMGVKGKKELPDSKELLEKVLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDQKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMKY
QVIDGEMYPPTVKDTQVEMIYPPHTPEHLQFAVGQEIFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQEYNFKQFLYNNSILIEHGLTQFVESFTKQNAGRV
AGGRNVPLAVQMVAKASIDQSRQMKYQSLNEYRKRFSLKPYASFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLMGNPICSPQYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTSFNVQNPPHAKTVTINASASHSRLDDINPTVLFKGR
STEL
Download sequence
Identical sequences ENSDORP00000002818 ENSDORP00000002818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]