SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002823 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002823
Domain Number 1 Region: 30-291
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.99e-85
Family Eukaryotic proteases 0.0000574
Further Details:      
 
Domain Number 2 Region: 581-635
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000979
Family Eukaryotic proteases 0.017
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000002823
Domain Number - Region: 514-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0744
Family Eukaryotic proteases 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002823   Gene: ENSDORG00000003004   Transcript: ENSDORT00000003004
Sequence length 856
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1326:88705:101626:-1 gene:ENSDORG00000003004 transcript:ENSDORT00000003004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPHLWLPLAILAIHPTPGALEDSAFTPTQEEPEDLDCGRPTPSARIVGGSDSQPGAWPW
QVSLHHGGGHVCGGSLIAPSWILSAAHCFVTNGSLEPAAEWTAVLGVHSQDGPLEGAHVR
AVAAILVPPNYSKVELGDDLALLRLASPARLGPVVRPVCLPRASHRFAHGTACWATGWGD
VQEADPLPLPWVLQEVELRLLGEAACQCLFSRRGPFNLTLQLLPGMLCAGYPEGRRDTCQ
GDSGGPLVCEEGGRWFQAGITSFGFGCGRRNRPGVFTAVAPYEAWIRDHVSGSQPGPTFP
KQPQEPQPGPGEPREENCTIALPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXWSLLCREEGTWFLAGLRDSFSGCLRPRAF
SPLQTHGPWISHVTRGAYLEDQLAWDWGPEGEETVTQTCPPRTVHGACGLRPEAPPSRLL
WPWLAEVHVAGDRVCTGILVAPGWVLAATHCVLXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVASAPPLLCQTEGGSWV
LMGMAVRGSSELFAAIGPEEAWISQTVGEAHILPHSGAPYWSPGGSNLCPPDMAGASGSA
PAAALFLLLLPPLIQG
Download sequence
Identical sequences ENSDORP00000002823 ENSDORP00000002823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]