SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000002867 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000002867
Domain Number 1 Region: 1-156
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.82e-38
Family HD domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000002867   Gene: ENSDORG00000003052   Transcript: ENSDORT00000003052
Sequence length 175
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_502:51337:62753:-1 gene:ENSDORG00000003052 transcript:ENSDORT00000003052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVPRTGWVYRNVKNPESVSDHMYRMAVMAMVTKDNHLNKDRCIRLALVHDMAECIVGDIA
PADNVPKEEKHRREEEAMKQITRLLPEDLRTELYELWEEYETQSSAEARFVKQLDQCEMI
LQAFEYEDENKPGCLQEFYDSTAGKFSHPEIVQLVSELETERNANIAEATNKPFS
Download sequence
Identical sequences ENSDORP00000002867 ENSDORP00000002867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]