SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003012 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003012
Domain Number 1 Region: 1-270
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.96e-76
Family Protein kinases, catalytic subunit 0.00000000055
Further Details:      
 
Domain Number 2 Region: 326-353,380-588,622-642
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.16e-65
Family Ankyrin repeat 0.0000753
Further Details:      
 
Domain Number 3 Region: 1289-1365
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000442
Family DEATH domain, DD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003012   Gene: ENSDORG00000003214   Transcript: ENSDORT00000003218
Sequence length 1403
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6350:33267:117813:1 gene:ENSDORG00000003214 transcript:ENSDORT00000003218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSREDIEREVSILKEVQHPNVITLHE
VYESKTDVILILELVAGGELFDFLAEKESLTEEEATEFLKQILNGVYYLHSLQIAHFDLK
PENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGTPEFVAPEIVNYEPLGLEADMW
SIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEYFSNTSGLAKDFIRRLLVKDPK
KRMTIHDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRS
FLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGLQHLLGSLSNYDVNQPNKXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSNAIYWASRHGHVDTLKFLNENKCPLDVK
DKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEETPLHCAAWHGYYSVAKSLCEAG
CNVNVKNREGETPLLTASARGYHDIVECLAEHGADLNASDKDGHIALHLAVRRCQVEVMK
ALLSHGCSVDFQDRHGNTPLHVACKDGNVPIVVALCEAGCNLDISNKXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXDGKTAEDLAKSAQHEHVAGLLARLRKDTHRGLFIQQLRPT
QNLQPRIKLKLFGHSSGKTTLESLCLSFSSAARLSXXXXXXXXXXXXXXXXXXXXXXXXX
SVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVAPSHHLHCSADDQSTKAIDIQNAC
LNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVVFSLEEPYEIQLNQVIFWLSFLKS
LVPVEEPIAFGGKLKNPLRVVLVATHADIMNVPRPAGGEFGYDKAASLLKEIRNRFGNDL
HISNKLFVLDAGASGSKDIKVLRNHLQEIRSQIVSGCPPMTHLCEKIISTLPSWRKLNGP
NQLMSLQQFVYDVQDQLNPLASEEDLRHIVHQLHSAGEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXGMDIHASDNSTRKLSRLDSDPMGKDWCLLAMNLGLPDLVAKYNTNS
GAPRDFLPSPVHALLREWTSYPESTVGILMSKLRELGRRDAADFLLKASSVFKINLDGNG
QEAYASSCNSGTSYNSISSVVSR
Download sequence
Identical sequences ENSDORP00000003012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]