SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003039 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000003039
Domain Number - Region: 88-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0808
Family Allantoicase repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003039   Gene: ENSDORG00000003246   Transcript: ENSDORT00000003247
Sequence length 152
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4218:9482:27430:-1 gene:ENSDORG00000003246 transcript:ENSDORT00000003247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEKEDDLDSLINEIFEEPNLDRKTFXXXXXXXXXXXXXXXXXXXXXXCGPVYLSGSSVP
WGIGTNTSQRACDRLRCIACDFWVVSYSDYMWDKSCDYLFFRNNMPDFHKLKTKLATKKG
ARAYACQCSWRTIEELTNLQTDHQLRWVCGKH
Download sequence
Identical sequences ENSDORP00000003039 ENSDORP00000003039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]