SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003061 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003061
Domain Number 1 Region: 182-301
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-17
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 288-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000108
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 3 Region: 9-35,83-105,155-211
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003061
Domain Number - Region: 329-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00395
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003061   Gene: ENSDORG00000003273   Transcript: ENSDORT00000003272
Sequence length 491
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3346:3564:65873:-1 gene:ENSDORG00000003273 transcript:ENSDORT00000003272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILTATLLALCLPSPGNAQQQCTNGFDLDRQSGQCLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIDECRTIPEACRGDMMCVNQNGGYLCIPRTNPVYRGPYSNPYS
TPYSGPYPAAAPPVSSAAASAGAASNYPTISRPLVCRFGYQMDEGNQCVDVDECATDSHQ
CNPTQICINTEGGYTCSCTDGYWLLEGQCLDIDECRYGYCQQLCANVPGSYSCTCNPGFT
LNEDGRSCQDVNECATENPCVQTCVNTYGSFICRCDPGYELEDDGVNCSDMDECSFSEFL
CQHECVNQPGTYFCSCPPGYILLDDNRSCQDINECEHRNHTCTPLQTCYNLQGGFKCIDP
IRCEEPYLLIGDNRCMCPAENTGCRDQPFTILFRDMDVVSGRSVPADIFQMQATTRYPGA
YYIFQIKSGNEGREFYMRQTGPISATLVMTRPIKGPRDIQLDLEMITVNTVINFRGSSVI
RLRIYVSQYPF
Download sequence
Identical sequences ENSDORP00000003061 ENSDORP00000003061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]