SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003089 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003089
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily vWA-like 5.42e-55
Family Integrin A (or I) domain 0.00047
Further Details:      
 
Domain Number 2 Region: 292-380
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000195
Family Laminin G-like module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003089   Gene: ENSDORG00000003304   Transcript: ENSDORT00000003305
Sequence length 1585
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5184:14537:183362:-1 gene:ENSDORG00000003304 transcript:ENSDORT00000003305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKSVHYDLVFLLDTSSSVGKEDFEKVRQWVANLVDTFEVGPGRTRVGVVRYSDRPSTAFE
LGLLGSREAVKAAARRLAYYGGHTNTGDALRFVTGHSFSARAGGRPGDPAVKQVAVLLTD
GRSQDLVLDAAAAAHAAGIRIFAVGVGAALREELHEIASEPKAAHVFHVSDFDAIDKIRG
KLRRRLCENVLCPSIRVEGDRFKHTNGETKEITGFDLMDLFNVKEILGKREDGAQSSYVR
MGSFPVVQRTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSIRLDGE
NKAVEYNAVGAFKDAVRVVFRGPQVNDLFDRDWHKMALSIQAQNVSLYIDCELVQTLPIE
ERENIDIQGKTVIGKRLYDSVPIDXXXXXXXXXXXXXXXXXXXXXXXXXXXCQVTVVTEP
PPVPPQPPTPGSEQIGFLKTINCSCPAGEKGEKGFVGPVGLPGPKGDTGATGLTGMPGPK
GEKGDMGRGPFIQGEKGEKGSRGLPGPPGRDGSKGVRGESGELGEPGLPGEVGMRGPQGP
PGLPGPPGHVGAPGLQGERGERGTRGEKGERGLDGFPGKPGETGEQXXXXXXXXXXXXXX
XGEAGPTCPPGVPGSVMQREGPKGEQGAPGPRGHQGPPGPPGAPXXXXXXXXXXXXXXXX
XXGKKGDVGPPGTPGASGLQGPPGPPGIPGPPGPGGPPLPGEIGFPGKPGPPGQTGSPGR
DGPNGPPGLPGSKGEPGERGEGGLPGRPGPRGEVGEQGLAGRPGEKGEAGLPGAPGFPGV
RGQKGDQGEKGDLGIPGLKGDRGEKGEAGPAGPPGLPGTTSLFTPHPRMPGEQGPKGEKG
DPGVPGEAGPQGRPGDPGPWGPIGPPGAKGQDGSHGAPGAAGSPGAPGPAGPPGVSGPPG
SAXXXXXXXXXXXXXXXXXXGTAGEEGRPGPAGPRGDPGPPGKGKDGEPXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGSRGLPGFPGPQGPAGQDGAPGNPGERGPPGKPGPSSVLSPEDINLLVKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDAGPQGIPGPPGVAGPQGSQGERGADGEVG
QKGDQXXXXXXXXXXXXXXXXXXGADGLAGAAGPPGVPGLQGKEGPPGPQGPSGIPGIPG
EEGKQGREGKPGPPGEPGKAGEPGLPGVDGARGPPGFKGHTGDSGPPGPRGEPGAMGPPG
QEGTPGKDGDAGPAGLQGPRGPRGPPGNSGSPGSPGDPGRPGTPGQKGTKGENGSPGLPG
FQGPRGPPGEAGEKGVPGKEGAPGKPGEPGAKGERGDPGTKGDKGAPGGKGQPGDPGIPG
HKGHTGLMGPQGPPGESGPAGPPGPAGQPGFPGLRGESPSMETLRRLIQEELGKQLETRL
YLLAQIPPQQGKTSQGRPGPPGPPGKDGLPGRAGPMGEPGRPGQGGLEGPSGPIGPKGER
GAKGDPGVPGVGLRGEMGPPGVPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXTSLAARPGNVKGH
Download sequence
Identical sequences ENSDORP00000003089 ENSDORP00000003089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]