SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003098 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003098
Domain Number 1 Region: 165-494
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 7.22e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000218
Further Details:      
 
Domain Number 2 Region: 496-628
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.26e-29
Family Ricin B-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003098   Gene: ENSDORG00000003316   Transcript: ENSDORT00000003314
Sequence length 632
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5713:214666:237870:-1 gene:ENSDORG00000003316 transcript:ENSDORT00000003314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHLRRLVKLHIKRHYHKKFWRLGAVIFFFIIVLILMQREVSVQYSQEESKMERNIKNKN
KMFDLMLEAVNNIKDAMPKMQIGAPVRQNIDVGERPCLQGYYTAAELKPALDRPPDPNAP
GASGKPYKTTNLSAEEQKEKERGERKHCFNAFASDRISLHRDLGPDTRPPECIEQKFKRC
PPLPTTSVIIVFHNEAWSTLLRTVHSVLYSSPAILLKEIILVDDASVDEYLHEKLEEYIK
QFAIVKIVRQKERKGLITARLLGAAVATAETLTFLDAHCECFYGWLEPLLARIAENYTAV
VSPDIASIDLNTFEFNKPSPYGSNHNRGNFDWSLSFGWEALPDHEKHRRKDETYPIKTPT
FAGGLFSISKEYFEHIGSYDEEMEIWGGENIEMSFRVWQCGGQLEIMPCSVVGHVFRSKS
PHTFPKGTQVIARNQVRLAEVWMDDYKEIFYRRNTDAAKIVKQKSFGDLSKRFEIKKRLQ
CKNFTWYLHTVYPEVYVPDLNPVISGFIKSVGQPLCLDVGENNQGGKPLILYTCHGLGGN
QYFEYSAHREIRHNIQKELCLHAAPGPLQLKPCAYKGQKTIVAEEQIWDIQKDQLLYNPA
LKLCLSATGEHPNLVSCNPSDLLQKWIFSQND
Download sequence
Identical sequences ENSDORP00000003098 ENSDORP00000003098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]