SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003123 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003123
Domain Number 1 Region: 219-469
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.56e-86
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 103-133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000223
Family LDL receptor-like module 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003123
Domain Number - Region: 6-59
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.018
Family beta-sandwich domain of Sec23/24 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003123   Gene: ENSDORG00000003340   Transcript: ENSDORT00000003340
Sequence length 470
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4296:37604:75671:-1 gene:ENSDORG00000003340 transcript:ENSDORT00000003340 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YENHEYQPEHLYPPPQAAPPSPYVAFPASYYPSPVPQYAPRVPTYTSSPAAGTQPPSPSG
AVYASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDNRCISGVECGSSGTCISAALWCDG
VSHCPNGEDENRCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSFY
SSQRVQDDSGATSFMKLISAGNIDLYRLHSDSCSSRMVVSLRCIECGVPSVSRQSRIVGG
WAASLEQWPWQVSLQVQGVHVCGGSIITPEWIVTAAHCVEKPLDRPRHWTVFAGILRQSL
MFYGHGHRVERVISHPSYDPKSKNNDIALFKLQTPLMLSDRVKPVCLPNPGLMLDPEQQC
WISGWGATFEKGKTSDMLNAAKVPLIQPSVCNSKLVYDNLITPAMICAGYLRGGIDSCQG
DSGGPLVTLKNGIWWLIGDTSWGSGCAKAYRPGVYGNVTVFTDWIYRQMR
Download sequence
Identical sequences ENSDORP00000003123 ENSDORP00000003123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]