SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003144 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003144
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.21e-16
Family Ovomucoid domain III-like 0.0055
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000277
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 260-305
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000887
Family EGF-type module 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003144   Gene: ENSDORG00000003362   Transcript: ENSDORT00000003362
Sequence length 374
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3597:56476:248990:-1 gene:ENSDORG00000003362 transcript:ENSDORT00000003362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLWESPRQCSGWTLCEGFCWLLLLPVMLLIVVRPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNSDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTATTKSEDG
HFARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCDAGYTGQHC
EKKDYSVLYVVPGPVRFQYVLIAAVIGTIQIAVICVVVLCITRKCPRSNRIHRQKQNTGH
YSSDNTTRASTRLI
Download sequence
Identical sequences A0A1S3G547
ENSDORP00000003144 XP_012883414.1.60039 ENSDORP00000003144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]