SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003161 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003161
Domain Number 1 Region: 396-789
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.06e-123
Family Ankyrin repeat 0.000000000000861
Further Details:      
 
Domain Number 2 Region: 228-479
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.72e-69
Family Ankyrin repeat 0.00000382
Further Details:      
 
Domain Number 3 Region: 5-95,129-304
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.86e-53
Family Ankyrin repeat 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003161   Gene: ENSDORG00000003379   Transcript: ENSDORT00000003381
Sequence length 1876
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_194:9807:105928:-1 gene:ENSDORG00000003379 transcript:ENSDORT00000003381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADAATSFLRAARSGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEI
ILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTA
AVLLQNDPNPDVLSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGITPLHIASRR
GNVIMVRLLLDRGAQIETRTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPI
HMAAQGDHLDCVRLLLQYNAEIDDITLDHLTPLHVAAHCGHHRVANVLLDKGAKPNSRAL
NGFTPLHIACKKNHIRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGAS
PNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAAIHTNMVKLLLE
YPLATTAGHTPLHTAAREGHDTLLLEKDASQCMTKKGFTPLHVAAKYGKVRVAELLLERD
AHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQMEVAR
SLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEG
HVPVADVLIKHGVSVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLH
QAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVLKVVTDETSVVLVS
DKHRMSYPETVDEILDVSEDEGEELAGSKAERQDSRDVDEEKELLDFVPKLDQVVESPAI
PRIPCVTPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTGFLVSFMV
DARGGSMRGSRHNGLRVVIPPRTCAAPTRITCRLVKPQKLNTPPPLAEEEGLASRIIALG
PTGAQFLSPVIVEIPHFASHGRGDRELVVLRSENGSVWKEHKSRYEESYLDQILNGMDEE
LGSLEELEKKRVCRIITTDFPLYFVIMSRLCQDYDTIGPEGGFLKSKLVPLVQATFPENA
VTKKVKLALQAQPVLDELVTKLLGNQATFSPIVTVEPRRRKFHRPIGLRIPLPPSWTDNP
RDSGEGDTTSLRLLCSVIGGTDQAQWEDITGTTKLVYANECANFTTNVSARFWLSDCPRT
AEAVNFATLLYKELTAVPYMAKFVIFAKMNDPREGRLRCYCMTDDKVDKTLEQHENFVEV
ARSRDIEVLEGMPLFAELSGNLVPVKKAAQQRSFHFQSFRENRLAIPVKVRREPGGFLSF
LRKAMKYEDAQHILCHLNITMPPCTKGSGAEDRRRTLTPLSLRYSILSESPLGFPSGTDK
ADMKMAVITEHLGLSWAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXENLYTALRNIDRNEIVNMLEGSGRQSRNLKPDRRHTDRDYSLSPSQMNGYSSLQDELL
SPASLHYALPSPLRADQYWNEVAVIDAIPLAATEHDTMLEMSDMQVWSAGLTPSLVTAED
SSLECSKAEDSDATQEWKLEGALSEEPQGPEMGSQDLVEDDTVDSDATNGLADLLGQEEG
QRSEEKRQEDSGAGRDSETEVSLVSGQQRAHARITDSPIVSKVLERSQDRAQDWDRQSSM
VSHLQDVTQSPWQEEIIQGPHSLQRKITTVQRLEPSGPQEYEKVLVSSRELVRMEQPEPS
SIQASREHNLRGPGEWLQAAGNTFSREIQGNELQNIPGEQVTEEQFTDEQGNIVTKKIIR
KVVRQVDSSGPDDTQQHEEVIVEGPLEDPSELEADIEYFMRHSKVELRGSGLQPDLIEGR
KGAQIVKRASLKRGKQ
Download sequence
Identical sequences ENSDORP00000003161 ENSDORP00000003161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]