SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003181 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003181
Domain Number 1 Region: 441-571
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.85e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000227
Further Details:      
 
Domain Number 2 Region: 89-310
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.51e-32
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000648
Further Details:      
 
Domain Number 3 Region: 262-438
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.54e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000818
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003181   Gene: ENSDORG00000003401   Transcript: ENSDORT00000003401
Sequence length 576
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4249:25857:58455:-1 gene:ENSDORG00000003401 transcript:ENSDORT00000003401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLFQQWRFPLELQMTREMASSGPSGRKMDNSMLVLIVGLSAIGAGAYAYKTIKXXXXXXX
XXXXXXXXXXXXXXXXXXXXXEGEPVSQVRPPSHVPFLIIGGGTAAFAAARSIRARDPGA
RVLIVSEDPELPYMRPPLSKELWFSDDPNVTKTLRFRQWNGKERSIYFQPPSFYVSAQDL
PHVENGGVAVLTGKKVVQLDVRGNMVKLNDGCQITYEKCLIATXXXXXXXXXXXXXXXXX
XXXXXXXXXVGDFRTLEKISREVKSITVIGGGFLGSELACALGRKARALGTEVIQLFPEK
GNMGKILPEYLSNWTMEKVRQEGVKVIPNAIVQSVGVSGGKLLIKLKDGRKVETDHIVAA
VGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDH
AVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATEQDNP
KSATEKSGTGIRSESETESEASEITIPASTPTVPQAPAQGEDYGKGVIFYLRDKVVVGIV
LWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Download sequence
Identical sequences ENSDORP00000003181 ENSDORP00000003181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]