SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003221 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003221
Domain Number 1 Region: 264-345
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.04e-20
Family Complement control module/SCR domain 0.0000077
Further Details:      
 
Domain Number 2 Region: 83-148
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.86e-18
Family Complement control module/SCR domain 0.000034
Further Details:      
 
Domain Number 3 Region: 140-214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000764
Family Complement control module/SCR domain 0.000054
Further Details:      
 
Domain Number 4 Region: 203-261
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000114
Family Complement control module/SCR domain 0.0000405
Further Details:      
 
Domain Number 5 Region: 22-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000983
Family Complement control module/SCR domain 0.0000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003221   Gene: ENSDORG00000003443   Transcript: ENSDORT00000003442
Sequence length 346
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4128:333682:347286:-1 gene:ENSDORG00000003443 transcript:ENSDORT00000003442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPALILFSSLLFHVAIAGRTCPQPEVLPFADVVPFKTYYLPGEQIQYSCKPGYVSRGG
MRRFTCPLSGMWPINTLKCTPRVCPFAGILENGSVRYTTFEYPNTITFTCNPGFYLNGTN
SAKCTEEGKWSPELPVCAPISCPPPPIPKFATLQVYKPSAGNNSMYRDTVVFECLPHHAM
LGNDTITCTEHGNWTELPECREVKCPFPSRPDNGFVNYPAKQVLLYKDKATYGCHETYTL
DGPEEVECTELGTWSAQPNCKASCILSVKKATVLYLGERVKFQEQFKNGMKHGDKVSFFC
KNKEKKCSYTEEAQCIDGFIEIPKCFKEHSSLAFWKTDAWDVKPCI
Download sequence
Identical sequences ENSDORP00000003221 ENSDORP00000003221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]