SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003280 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003280
Domain Number 1 Region: 337-418
Classification Level Classification E-value
Superfamily MIR domain 1.44e-18
Family MIR domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003280   Gene: ENSDORG00000003506   Transcript: ENSDORT00000003506
Sequence length 751
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3630:80992:317290:-1 gene:ENSDORG00000003506 transcript:ENSDORT00000003506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPRTMAGGLVGCELRARQGRCGPQASRAAVRDVAAEAAARSPKPPAQSWRRLEAAGQWAL
LALVTLLSFATRFHRLDQPPHICWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYL
SGYDGTFLFQKPGDKYEHHNYMGMRGFCAFLGSWLIPFAYLTVLDLSKSLPAALLTAALL
TFDTGCLTLSQYILLDPILMFFIMAAMLSMVKYNSCADRPFSAPWWFWLSLTGISLAGAI
GVKFVGLFIIVHVGLNTISDLWHLFGDLSLSLVTVGKHLTARILCLIVLPLVLYVAIFAV
HITVLNKSGPGKCLFYSAXXXXXXXXXXXXXXXXXXLAYGSVITVKNLRMAIGYLHSHRH
LYPEGIGAHQQQVTTYLHKDYNNMWIIKKHNTNSDPLDPSLPVEFVRHGDIIRLEHKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNISLEVLQPSFAE
VLLESHMIMILGNNGLKPKDNEFTSKPWHWPINYQGLRFSGTNDTDFRVYLLGNPVVWWL
NLVSIALYLVLGSTIAIAMQRGVQLPMELEGQIQMLLRGGGQMLLGWMLHYFPFFLMGRI
LYFHHYFPAMLFSSMLTGILDSLLRLCAWGVGXXXXXXXXXXXXXXXXXXXXXXXXXFYL
FHPLAYGMVGPLAQDPESPMAGLRWLESWDF
Download sequence
Identical sequences ENSDORP00000003280 ENSDORP00000003280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]