SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003291 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003291
Domain Number 1 Region: 396-785
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.02e-106
Family Ankyrin repeat 0.00000000141
Further Details:      
 
Domain Number 2 Region: 9-97,131-222,256-290
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.03e-44
Family Ankyrin repeat 0.0000592
Further Details:      
 
Domain Number 3 Region: 4038-4148
Classification Level Classification E-value
Superfamily DEATH domain 9.42e-26
Family DEATH domain, DD 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003291   Gene: ENSDORG00000003517   Transcript: ENSDORT00000003517
Sequence length 4332
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3949:24591:204137:-1 gene:ENSDORG00000003517 transcript:ENSDORT00000003517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDANASYLRAARAGHLEKALDYIKNGVDINICNQNGLNALHLASKEGHVEVVSELLQREA
NVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAA
ALLLQNDNNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGLTPIHVAAFMGHVNIVSQLMHHGAS
PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQL
LQQGASPNAATTSGYTPLHLSAREGHEDVASFLLDHGASLSITTKKGFTPLHVAAKYGKL
EVANLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVDMVSLLLSRNANVLSNKNGLT
PLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAK
TKNGYTPLHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVT
EETITTTTIIEKHKMNVPETMNEVLDMSDDEVRKANAPEMLSDGEYISDVEEGEDALTGD
TDKYLGPQDLKELGDDSLPAEGYMGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEE
LLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRG
SRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGP
VIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGK
KRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGL
QAQPVPEEIVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVANGYKGDTT
PNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLAT
QLYRELICVPYMAKFVVFAKMNDPVESSLRCFCMTDDKVDKTLEQQENFEEVARSKDIEV
LEGKPIYVDCYGNLAPLTKGGQQLVFNFYAFKENRLPFSIKIRDTSQEPCGRLSFLKEPK
TTKGLPQTAVCNLNITLPAHKKETESDQDDETEKADRRQSFASLALRKRYSYLTEPGMIE
RSAGATRSLPTTYSYKPFFSTRPYQSWTTAPITVPGPAKSGFTSLSSSSSNTPSASPLKS
IWSVSTPSPIKSTLGASTTSSVKSISDVASPIRSFRTISSPIKTVVSQSPYNIQVASGTL
GRAPTITEATPLKGLASSSTFSSRTSPVTTAGSLLERSSITMTPPASPKSNINMYSSSLP
FKSIITSTAPLISSPLKSVVSPAKSTMDAISSAKVTMASSLSSPLKQMPGHAEVPLVNGS
ISPLKYPSSSTLINGCKATATLQDKISTATNSVSSVVNAATDXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSALYTSLGSSIAATTSSVTSSIITVPVYSVVNVLPEPALKKF
PDSNSLTKSAAALLSPIKTLTTEPCPQPHFNRTSSPVKSSLFLAPSALKLSTPSSLSSSQ
EILKDVAEMKEDLMRMTAILQTDVPEEKPFQPELPKEGRIDDEEPFKIVEKVKEDLVKVS
EILKKDVCVDNKGPPKSPKSDKGHSPEEDWIEFSSEEIREARQQAATSQSPSLPERVQVK
AKAASEKDYNLTKVIDYLTNDIGNSSLTNFKYKFEDVKKDGEERQKRILKPAIALQEHKL
KMPPASMRPSTSEKELCKMADSFFGTDAILESPDDFSQHDQDKSPLSDSGFETRSEKTPS
APQSAESTGPKPLFHEVPIPPVITETRTEVVHVIRSYEPSTGDAPQSQPEEPMSPKPSSA
FMELEPKPTTSSIKEKVKAFQMKANSEEDDHSRVLGKGMRVKEETHITTTTRTVYHSPPG
SEGTSERIEETMSVHDIMKAFQSGRDPSKELAGLFEHKSAMSADVHKSAAETSAQHAEKD
NQMKPKLERIIEVHIEKGNQAEPTEVIIRETKKHPEKEMYVYQKDLSRGDINLKDFLPEK
HDAFPCPEEQGPQEEEELTAEESLPSYLESSRVNTPVSQEEDSRPSSAQLLSDDSYKTLK
LLSQHSVEYHDDELSELRGESYRFAEKMLLSEKLDVSHSDTEESVTDLAGPPSSELQGSD
KRSREKVATAPKREILSKIYKDVSENGVGKVSKDERFDKVTVLHYSGDVSSPKHAMWMRF
TEDRLDRGREKLMYEDRVDRTVKEAEEKLTEVSQFFRDKTEKLNDELQSPEKKPRPKNGK
EYSSQSSTSSSPEKVLTELLASNDDWVKARQQGPDGPQGCPQAEEKKVSSLPSSPEKVLP
QQSEDGQSTMEAKGGATHSKASEGPQSGFQLKQSKLSSIRLKFEQGTHAKSKDLSQEEKK
ADGQSRIPVKKIQESKLPVYQVFAREKQQKAIDLSEESVCAQKEFMVLKAKDEPAQSSET
VVNDSGSNDVKKQRTEMSSKAMPDYFSEQQAKDLACHVTSDLATKGPWDKKVFRTWESSG
ATNHKSQKEKLSHVIVHGVRENHNTHPESKGHYCNCLTFIFPKLLTNGSLSELKEMTVKS
PSKKVLYREYVVKEGERVGGALDQPARRSENSAMSHIPVRVADERRMLASNIPDGFCEQS
TFPKRELSQKLSQSSTSKETVETQHFNSIEDEKVTYSEISTVSKHQSYVGLCPPLDETET
SPTKSPDSLEFSPGKDSPSSDVFDHSPTDALGKRAPLAQTEGGKEIKTLPVYVSFVQVGK
QYEKEIQQGSVKKIISQECKTVQETRGTFYTTRQQKQPPSPQGSPEDDTLEQVSFLDSSG
KSPLTPETPSSEEVSYEFTSKTPDSLIAYIPGKPSPIPEVSEESEEEEMARSTSLKQTVE
ESTAECEAPKDVSRDFIQRPKPNRVAYIEFPPPPPLDADQMESEKKLHYLPEREVDMIEV
SLQDEHDKYQLAEPVIRVQPPSPIPPGADASESSDDESVYQPVPVKKYTFKLKEVEDEQK
EMTKVKAAAEKASTKLKEAESNGSGKENEFGLGLDSPQNETTQNGNNDQSITECSIATTA
EFSHDTDATEIDSLDGYDLQDEDDGLTESDSKLPGQMMELKKDVWNTEGILKPADRSFSQ
SKLEVIEEEEGKVVPDEDKPSSKSSSSERTPDKTDQKSGAQFFTLEGRHPDRSVFPDTYF
SYKVDEEFATPFKTVATKGLDFDPWSNNRGEDEVFDGNKSREEESKPFGLAVEDRSPATT
PDTTPARTPTDESTPTSEPNPFPFHEGKMFEMTRSGAIDMSKRDFVEERLQFFQIGEHTS
EGKSGDQGEGDKSMVTDTPQPQSGDTTVENNLERNVEATAVEPNPSIPTSGEYQEGPASS
GSLEKITATCNTSKVDPKLRTPIKMGISASTMTMKKEGAGEGTDKMEAVMTSGQGLENET
MAVNSNPTVSQMGSRPQEKHDFQKDNFNNNNNLDSSTVQTDHITSHVVLTEQSAPTCVTE
KTNPVKGSSGKKTGVLQGPCAKDRQKAPGEQQKTKESIGVRRKSKLPIKATSPKDTCPAN
HMPNMKASKTKQVSRSEKTKTFTTSSCLDTKSRIPVKHTHREELVSVRKACTTRKQGQPE
KGKAKQLPSKLPVKVRSTYVTTATTTTTTTTTTTTTVKVRRSQLKEVCKHSIEYFKGISG
ETLKLVDRLSEEDKKMQSELSDEEESTSRNTSLSETSRGGQPSVTTKSTRDKKTEAAPLK
SKSEKAGSERRSSRRTGPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVE
NPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRS
FADENNVFHDPVDGWQNETSSGNLESPAQARRVTGGLLDRLDDSPDQCRDSITSYLKGEA
GKFEANGTHAEVTPEEKTKSYFPESQNDIGKQTTKETLKPKVPGSGGAEEPALPLTTHQK
SLEETSKFVREEPKPCVPVSMKKLSRTSPADSKPRLNLHEEEGASGSEPKQGEVYKMKTK
KEIRHVEKKSHS
Download sequence
Identical sequences ENSDORP00000003291 ENSDORP00000003291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]