SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003321 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003321
Domain Number 1 Region: 584-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.66e-46
Family Ankyrin repeat 0.0000465
Further Details:      
 
Domain Number 2 Region: 428-525
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.36e-29
Family Pyk2-associated protein beta ARF-GAP domain 0.0000466
Further Details:      
 
Domain Number 3 Region: 32-196
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.43e-26
Family FCH domain 0.088
Further Details:      
 
Domain Number 4 Region: 316-407
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003321   Gene: ENSDORG00000003550   Transcript: ENSDORT00000003551
Sequence length 903
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_850:5918:64163:-1 gene:ENSDORG00000003550 transcript:ENSDORT00000003551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEQLCVAEFLAVTAEDLSSPAGAAAFAAKMPRYRGAALAREEILEGDQAILQRIKKAIR
VIHSSGLGHVENEEQYQEAVESLGNSHLSQSSHELSTGFLNLAVFTREVAALFKNLVQNL
HNIVSFPLDSLVKAQLRDGRLDSKKQLEKAWKDYEAKVARLEKERDRARVPGAVPGELAQ
DTQRERRVFQLHMCEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXIRRVWQKRKCGVKYGCLTMSHSTINRPPVKLTLLTCQVRPNPEEK
KCFDLVTHNRTYHFQAEDEHECEAWVSVLQNSKDEALSSAFLEEPSVGPGSYGGSGLDGE
PQYLTKLLIAEVKSRPGNSQCCDCRAPDPTWLSTNLGVLTCIHCSGVHRELGVRFSRMQS
LSLDLLCPTELLLALNIGNMCFNEVMEAQLPSHGGPKPSAESDXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPELALHLAVRVANQAS
LPTVDFIIQNCGHLDAKATDGNTALHFAALHGQPDCLKLLLKGRAPVGTVNEAGETALDI
ARKKQHKECEELLEQAQEGTLAFPLHVDYPWGLSTEPGSDSEEEEEEKRCSLKPPAHACR
ARGKLDITNKTYETITSLEPAAPQSQNEDSPPPLPIKISSRTMVPGHLGHASGDRSGIPS
LSSEPSEASESRDSPATSSSILTSPVEPGGPSQSLPGLEEGLQESPGTSQSILASGTTPA
EVHLPIRFSSESTRSYRRGGRSPEDCPSAQQPLPRKNIPAAFIEGDGSKTGVLAPSSLQL
FQD
Download sequence
Identical sequences ENSDORP00000003321 ENSDORP00000003321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]