SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003323 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003323
Domain Number 1 Region: 593-729
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-43
Family C-type lectin domain 0.00013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003323
Domain Number - Region: 215-371
Classification Level Classification E-value
Superfamily Tropomyosin 0.000719
Family Tropomyosin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003323   Gene: ENSDORG00000003553   Transcript: ENSDORT00000003553
Sequence length 737
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4329:7015:75614:-1 gene:ENSDORG00000003553 transcript:ENSDORT00000003553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDQTGKKALSTNELSTFRSDILDLRQQLREI
TEKTTKNKDTLEKLQASGEVLVDRQSQLKESLENNSFLITTVNKTLQAYNGYVTNLQQDT
SVLQGNLQNQMYSHNVVIMNLNNLNLTQLQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQ
QVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLSSFTGQMDNITTISQ
ANEQNLKDLQDSHKDAENRTAIKFSQLEERFQLFETDIVNIISNISYTAHHLRTLTSNLN
EVRTTCTDTLTKHTDDLTFLNNTLANIRLDSVSLRMQQDMMRSRLDTEVANXXXXXXXXX
XXXXXXXXXXXXXXXXXXPPGPRGPKGDRGSQGPPGPTGNKGQKGEKGEPGPPGPAGERG
PIGPAGPPGERGGKGSKGSQGPKGSRGTPGKPGPQGPSGDPGSPGPPGKDGLPGPQGPPG
FQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGLPGPPGPSGAVEPLALQNVPTPVPEAN
GCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSAHLVFINSREEQQWIKKQIVGRDSHW
IGLTDSEQENEWKWLDGTPADYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDFQCEDI
NNFICEKNRETDLSSAL
Download sequence
Identical sequences ENSDORP00000003323 ENSDORP00000003323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]