SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003355 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003355
Domain Number 1 Region: 234-437
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.1e-55
Family Reprolysin-like 0.00031
Further Details:      
 
Domain Number 2 Region: 527-584
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 1.19e-16
Family TSP-1 type 1 repeat 0.0003
Further Details:      
 
Domain Number 3 Region: 1057-1116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000109
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 4 Region: 874-933
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000012
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 5 Region: 933-990
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 996-1057
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000628
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 819-872
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000183
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003355   Gene: ENSDORG00000003587   Transcript: ENSDORT00000003587
Sequence length 1160
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1300:64821:156937:-1 gene:ENSDORG00000003587 transcript:ENSDORT00000003587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YVFVTPVEVDSGGSYISHDILHNGRKKRSAQGARSSLHYRFSAFGQELHLELKPSAILSS
HFIVQVLGKDGATETWEPTGQRCFYQGFIRNDSFSSVAVSTCAGLSGLIKTRKNEFLISP
LPQLLAQVHNYSSPAGHQPHVLYKRTAEQKIQQYHGYPSSHQTSPGHSPGQSPPAPQSQE
TEHHPHRMWQRQHFCGRRKKYAPKPPSEDTYLRFDEYGSSGRPRRSAGKSQRGLNVETLV
VADKKMVEKHGKGNVTTYILTVMNMVSSLFKDGTIGSDINIVVVSLILLEQEPGGLLINH
HADQSLNSFCQWQSALVGKNGKRHDHAILLTGFDICSWKNEPCDTLGFAPISGMCSKYRS
CTINEDTGLGLAFTIAHESGHNFGMIHDGEGNPCRKAEGNIMSPTLTGNNGVFAWSSCSR
QYLKKFLSTPQAGCLVDEPKQTGQYKYPDKLPGQIYDADTQCKWQFGAKAKLCSLGFAKD
ICKSLWCHRMGHRCETKFMPAAEGTVCGLSMWCRQGECVKLGELGPRPVHGQWSTWSKWS
ECSRTCGGGVKYQERHCNNPKPQYGGKFCPGSNRIYKLCNINPCHENSLDFRAQQCAEYN
NKPFRGWFYQWKPYTKVEEEDRCKLYCKAENFEFFFAMSGKVKDGTPCSSHKNDVCIDGI
CEPVGCDHELGSKAVADACGICKGDNSTCKFYKGLYRNQYKANEYYPVVIIPAGARSIEI
QELQVSSSYLAVRSLSQKYYLTGSWRIDWPGEFPFAGTTFEYQRSATRPERLYAVGPTNE
TLVFEILMQGKNPGIAWKYALPKALNGTPPATKKPHHAWSAVLSECSVSCGGGYISVKAI
CLRDQSTQVNSSFCNGRTKPATEPKICNAFSCPAYWMPGEWSVCSKSCSGGQQSRKIQCV
QKRPFQEEEEAVLHSLCPVSTPTQVQVCNSHECPPEWSPGPWSQCSKTCGRGVRRRELLC
KGSSAESLPESRCSGSPRPEAQEGCVLGRCPKNNRLQWVASSWSECSTTCGLGVRKRDLK
CSEKTLQGKLVVFPERRCRHMKKPNLDMEEACNRRACPVYSVAAAWYSSPWQQCTVTCGG
GMQTRSVHCVLQGRPSSSCLLHQKPPGLRACNTNFCPAPEKRDDPSCVDFFSWCHLVPQH
GVCNHKFYGQQCCKSCTRKS
Download sequence
Identical sequences ENSDORP00000003355 ENSDORP00000003355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]