SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003359 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003359
Domain Number 1 Region: 289-382
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000738
Family Ricin B-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003359   Gene: ENSDORG00000003592   Transcript: ENSDORT00000003592
Sequence length 497
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_5291:99782:236728:-1 gene:ENSDORG00000003592 transcript:ENSDORT00000003592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPDTNEQKEKITEKAILSMTAKEHHNAQAEMSRLIDELQTAIKSYRGHLSKLGPQLQAE
QEQFSSYVYQHIKSLPANTLVPGGLQLKVFENGKDTGEICIYISKKDLESNSPTQTGDIM
QRLLLKIHQRLQASSINPPGLNFSPTRLFDEHGQEIKDPLLLKNEQKVWVSYGAAYRSPL
SPVLSLTFDQVTAFVRSGVRVACKASMDPNALLLPGCENWEVCEGFPINFDFTSQQIPDQ
FEKVDMDSHFLQNKVDPNIVLRASVSIGKRSSLSSEVSSRSQTAPAALWSAANVWLITKT
GMILSRAITQGCLAVGHPIRVKAVEGVSLEGYTLIQKRHKGDESQRWVFGTDGCIHSKAY
PQLVLTYLEELSTHVDVTQAEYHIHHGIWTTAHQECGKNIADEVLKKCPSNSSLKPLPEL
SDTHATPEGSLEETEQLTVALVRKLEEKHPKASAQRWAIKHEGTSKPGQWKHSKVDNPLW
NKLTYMWPVLPNGQINE
Download sequence
Identical sequences ENSDORP00000003359 ENSDORP00000003359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]