SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003394 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003394
Domain Number 1 Region: 358-454,508-539
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-27
Family SPRY domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003394   Gene: ENSDORG00000003629   Transcript: ENSDORT00000003629
Sequence length 596
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2613:8127:27300:1 gene:ENSDORG00000003629 transcript:ENSDORT00000003629 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGTGPGPGSGTGPGPGAAANANTTEEGETKPVAAAATAPAGEGPSAAPATEPSSGEA
ESGDANSVDVSGGVETESSNGKDTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXSCLPFMTNYSFHCNVCHHSGNTYFLRKQAXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMDLSNIGPAYDNQK
QSSTVTTSGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPQL
KISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQALFY
DKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCT
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHVETEVDGRRSPPWELD
Download sequence
Identical sequences ENSDORP00000003394 ENSDORP00000003394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]