SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003417 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003417
Domain Number 1 Region: 128-200
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.11e-17
Family Complement control module/SCR domain 0.00011
Further Details:      
 
Domain Number 2 Region: 189-251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.84e-17
Family Complement control module/SCR domain 0.00012
Further Details:      
 
Domain Number 3 Region: 63-138
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000144
Family Complement control module/SCR domain 0.00014
Further Details:      
 
Domain Number 4 Region: 2-68
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000005
Family Complement control module/SCR domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003417   Gene: ENSDORG00000003652   Transcript: ENSDORT00000003652
Sequence length 327
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_6312:16868:30742:1 gene:ENSDORG00000003652 transcript:ENSDORT00000003652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCGLPAQVPNAQPTLGDLQSFPEGHTVTYKCKEGFEKIPGKPDSVVCLPSHQWSELGEFC
NRSCKIPPRLNYAFLKKEYSKQNYFPVGSIVEYECRPGYRKDITKSEKLTCLPSLEWSKP
TEFCQKRSCPNPGEIQNGAINIKTDILFGSSISFSCNKGFKLVGATSSYCVLTDNTVGWS
DPLPECVEIYCPDPPVVKNGIMRGESNTYTYSQTVSYECTKGFTLVGNSSLYCDIKDDDH
GEWSSPPPQCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXVANYLY
Download sequence
Identical sequences ENSDORP00000003417 ENSDORP00000003417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]