SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003444 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDORP00000003444
Domain Number - Region: 332-392
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00142
Family Ankyrin repeat 0.0074
Further Details:      
 
Domain Number - Region: 616-671
Classification Level Classification E-value
Superfamily OmpH-like 0.068
Family OmpH-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003444   Gene: ENSDORG00000003681   Transcript: ENSDORT00000003681
Sequence length 723
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4189:1327:74780:-1 gene:ENSDORG00000003681 transcript:ENSDORT00000003681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGMPHGYDILIVYSQDAEEWCHYLQELFLSSRQVRSHKMLSHRLGLDVSVSAEDLRV
FLSARCVLVLLSAELVQLFYQPSLLPLLQRAFHPPRRVLRLLCGVQAHHEQFLPLFPDWA
HWQELTCDDEPEAYLAAVRKAISEDSGCDSVTDTEPEDEKVLPHSKQLSLPSETTPGNLM
VVQPDRIRCGAQTTVYIIMRCKLDDRVSTEAEFCPEDSPSVRVEAILENEYTISVKAPDL
SSGNVCLKIYSGDLVVCETIISYYTDMEEIGNLLSNAANPVEFMCQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQRDEELPTLLHFAAKYGLKNLTALLLTCP
GALQAYSVANKHGHYPNTLAEKHGFKDLRQFIDEYVETVDMLKSHIKEELMQGEEDNAVY
ESMAHLSTDLLMKCSLNPGCDDELYESMAAFAPAAAEDLYVEMLQASASNPVPRESFSRP
TKDSMIRKFLEGRSVETASLEREQHHLDREEDVYHIVNDDEAFSVDLASRPPVPVPRPEA
SAIGSQPLPDDEPYISKXXXXXXXXXXXXXXXXXXXXXXXPPVRPSRDRPQSSIYDPFAG
MKTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKRRSESFRFQQENLKRLRESITR
RQREKQKSGKQTDLEITVPIRHSQHPGKVEFGVYESGPRKSVFPAMTELRRGDWKTDSTS
STA
Download sequence
Identical sequences ENSDORP00000003444 ENSDORP00000003444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]