SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003503 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003503
Domain Number 1 Region: 9-150
Classification Level Classification E-value
Superfamily Nudix 5.42e-28
Family MutT-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003503   Gene: ENSDORG00000003751   Transcript: ENSDORT00000003751
Sequence length 165
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3040:5109:9641:1 gene:ENSDORG00000003751 transcript:ENSDORT00000003751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSVEPLRRRPGVGVGVVVTSYKHPRCVLLGKRKGSFGAGSFQLPGGHLEFGETWEECA
RRETWEEAALHLENVRFASVVNSFVEKENYHYVTILMKGEVNRTQDPEPKNVEPEKNESW
EWVPWEEFPPPDQLFWALRCLKEQGYNPFTEELNHLEGYKGNHLQ
Download sequence
Identical sequences ENSDORP00000003503 ENSDORP00000003503

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]