SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003526 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003526
Domain Number 1 Region: 222-340
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 3.14e-39
Family Fibrinogen C-terminal domain-like 0.0000358
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003526
Domain Number - Region: 117-149
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0703
Family Fibrinogen C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003526   Gene: ENSDORG00000003775   Transcript: ENSDORT00000003775
Sequence length 344
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2034:109812:115368:1 gene:ENSDORG00000003775 transcript:ENSDORT00000003775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKNHLSAVTWLCVFLVAFVGHPVWLQKPPKRKTPAQLKAAICCEEMKELRAQVANLSSL
LADLSKKQESDWVSVVMQVMELESNGKRMESRLTDAESKYSEMNNQIDIMQLQAAQTITQ
TSADAIYDCSSLYQKNYRISGVYKLPPDEFLGSPELEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDWEGNMRFAEYSHFALSN
EFNSYRLFLGNYSGNVGKDALLYHNNTVFSTKDKDNDNCLDNCAQLRKGGYWYNCCTDSN
LNGVYYRLGEHRKHLDGITWYGWHGATYSLKRVEMKIRPEAFKP
Download sequence
Identical sequences ENSDORP00000003526 ENSDORP00000003526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]