SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003556 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003556
Domain Number 1 Region: 322-513
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.09e-47
Family Hemopexin-like domain 0.00071
Further Details:      
 
Domain Number 2 Region: 123-287
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 8.07e-44
Family Matrix metalloproteases, catalytic domain 0.0000551
Further Details:      
 
Domain Number 3 Region: 31-97
Classification Level Classification E-value
Superfamily PGBD-like 0.0000000000000377
Family MMP N-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003556   Gene: ENSDORG00000003809   Transcript: ENSDORT00000003808
Sequence length 521
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_48:117568:142697:-1 gene:ENSDORG00000003809 transcript:ENSDORT00000003808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHGGFLLRALALLLWGAWDAAEPAERGDPELRLEAEAFLEKYGYLNENVPRASASTRF
SNALREFQWVSQLPVSGVLDGPTLRQMTRSRCGVADTGSHAAWRERISALFAGPRAKMRR
KKRFAKQGHKWYKQHLSYRLVNWPEHLPESAVRGAVHAAFQLWSNVSGLEFWEAPATGPA
DIRLTFFQGDHNDGLSNAFDGPGGALAHAFLPRRGEAHFDLDERWSLSRRRGRNLFVVLA
HEIGHTLGLTHSPAPRALMAPYYKRLGRDALLSWDDVLAVQNLYGKPLGRSVAMQLPGKL
FTDFEAWNPHNSQGRRPETRGPKYCHYSFDAITIDGQQRLYIFKGSHFWEVAVDGNVSEP
RPLQERWTGLPPTIDAAAVSLEDGDFYFFKGSRCWRFQGSQPVWKSSQLCRRGGLPRHPD
AALFFPPLRRLILFKGARYYVLTQGGLQVKPYYPRSLRDWSGVPEEVSGALPRPDGSIIF
FRDDSYWLLDQAKLQVTTSGRWATELPWMGCWNANSEGALF
Download sequence
Identical sequences A0A1S3EWB9
ENSDORP00000003556 XP_012868713.1.60039 ENSDORP00000003556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]