SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003566 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003566
Domain Number 1 Region: 215-320
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.8e-19
Family Reprolysin-like 0.02
Further Details:      
 
Domain Number 2 Region: 837-876
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000196
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 3 Region: 525-566
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000641
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003566   Gene: ENSDORG00000003818   Transcript: ENSDORT00000003818
Sequence length 946
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4924:13995:32720:1 gene:ENSDORG00000003818 transcript:ENSDORT00000003818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLGVLALALIGRPAGSSEPEWEVVVPIRLDPDINGRHYYRRGPEDSGDQGLIFQITAF
QEDFYLHLTPDAQFLAPAFATEYLGVPLQRLTGSSLDLRRCFYSGDVNAEPDSFAAVSLC
GGLHGAFGYRGAEYVISPLPNASAQAAQRNRQGAHLLRRRSAPGGPSGDPTSRCGVASGW
NPSILRALDPYKPGRTGLGESHSRRRAGRAKRFVSIPRYVETLVVADESMVKFHGADLEH
YLLTLLATAARLYRHPSILNPINIVVVKVLLLGDRDSGPKVTGNAAMTLRNFCAWQKKLN
KVSDKHPEYWDTAILFTRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWPYDCSRTCGGQLARRQCS
NPTPANGGKYCEGVRVKYRSCNLEPCPNSASGKSFREEQCEAFNGYNHSTNRLTLAVAWV
PKYSGVSPRDKCKLICRANGTGYFYVLAPKVVDGTLCTPDSTSVCVQGKCIKAGCDGNLG
SKKKFDKCGVCGGDNKSCKRVTGLFTKPMHGYNFVVSIPAGASSIDIRQRGYKGLIGDDN
YLALKNSQGKYLLNGHFVVSAVERDLVVKGSLLRYSGTGTAVESLQASRPILEPLTVEVL
SVGKMTPPRVRYSFYLPKEPREDKSSHPKDPRGPSVLHNSVLSLSNQVEQSDERVHTRWV
ARSWGPCSASCGSGLQKRSVDCRGSPGQLGASACDTAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRRKPQELDFCILRPC
Download sequence
Identical sequences ENSDORP00000003566 ENSDORP00000003566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]