SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003583 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003583
Domain Number 1 Region: 2208-2301
Classification Level Classification E-value
Superfamily C-type lectin-like 1.7e-30
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 509-648
Classification Level Classification E-value
Superfamily FAS1 domain 4.05e-30
Family FAS1 domain 0.0018
Further Details:      
 
Domain Number 3 Region: 1472-1520,1598-1712
Classification Level Classification E-value
Superfamily FAS1 domain 2.35e-26
Family FAS1 domain 0.0023
Further Details:      
 
Domain Number 4 Region: 1712-1867
Classification Level Classification E-value
Superfamily FAS1 domain 2.22e-25
Family FAS1 domain 0.0052
Further Details:      
 
Domain Number 5 Region: 966-1123
Classification Level Classification E-value
Superfamily FAS1 domain 4.32e-23
Family FAS1 domain 0.0044
Further Details:      
 
Domain Number 6 Region: 2299-2461
Classification Level Classification E-value
Superfamily FAS1 domain 4.45e-19
Family FAS1 domain 0.0083
Further Details:      
 
Domain Number 7 Region: 387-499
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000000112
Family FAS1 domain 0.0056
Further Details:      
 
Domain Number 8 Region: 1131-1248
Classification Level Classification E-value
Superfamily FAS1 domain 0.0000000379
Family FAS1 domain 0.0067
Further Details:      
 
Domain Number 9 Region: 932-990,1257-1304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000121
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 10 Region: 1543-1581
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000858
Family Merozoite surface protein 1 (MSP-1) 0.054
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003583
Domain Number - Region: 1372-1508
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 2009-2136
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000816
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number - Region: 231-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.059
Further Details:      
 
Domain Number - Region: 2140-2175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 321-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003583   Gene: ENSDORG00000003832   Transcript: ENSDORT00000003836
Sequence length 2572
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_97:73634:106947:1 gene:ENSDORG00000003832 transcript:ENSDORT00000003836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAQSLLPLCLLAFCLVGSSVIRGQKVRSKRCDVKTKFVTHTPCTTCAAIKKVVCPLGW
LRHFPEKITKDCQYEVQLGASLVSLSGCSLECSKDVVQKACCPGYWGSLCYECPGGAETP
CNGHGTCLDGISGNGTCVCQENFSGSACQECQDPQRFGPDCQSVCSCVHGVCSHGPQGDG
SCLCFAGYTGPRCDQELRVCKERSCPQNSQCSAEAPGCRCLPGHTLQDSKCIAPNPCQSS
PCSPLASCSVSPTGQAQCHCPENYHGDGKICLPHDPCTNNFGGCPSNSTVCIYQKPGTAV
CSCQPGLFRFNSNTSAGCFAYCSRHSCDQSATCQVTPNGKTRCVCKEGEVGDGRACYGHL
LHEVQKAHQIGLVFLKLRVAISMFEQGCQDILTTSGPFTVLVPSISSSTGSSKTMNAALA
QQLCRQHIIAGQHILEDTKSPSIRRWWTLAGQEITVTFNRIRYTYTYKDQPQQTXXXXXX
XXXXXXGIFHVVTALQWQVSPKLPGDPKKTVGQILASTEDFSRFETILENCGLPSILEGP
GPFTVFAPSNEAVDSLRDGRLIYLFTGGLSKLQELVKYHIYSHGQLTVEKLISKGRVLTM
ANQILAVNISEEGRILLGPNGIPLRRVDVPAANGVIHMLEGILLPPTILPILPKHCDEEQ
HKIVMGSCVDCQALNTSTCPPNSVKLDIFPKECVYTHDPTGLNVLRKGCAHYCNQTIMKP
GCCKGFFGPDCTQCPGGFSNPCYGKGNCSDGIQGHGACLCFPDYKGIACHICSNPNKHGD
QCQEDCGCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSRCTCKLGFAGDGYECSPIDPCRVGNGGC
HGLATCQAVGGGQRICTCPPRFGGDGFSCYGDIFRELEANAHFSAFFQWFKSTGITLPAD
SNVTALVPSESAIRRLSPKDRAFWLQPKMLPTLIRAHFLQGAFSEEDLAQMSGQKVATLS
STTRWEIHNISGRVWVQNASVDVADLLATNGVLHIISQVLLPPQGDVLARKGLLQQLDLV
PAFHLFRDLLQRHKLVSQIEAAAAYTIFIPTNHSLEAQGNSSSLDADTVRHHVILGEALS
VETLSKGGHRNSLLGTAHWLVFYNHSSQPEVNHVPMEGPLLEAPGQSLFGLSGILTVGSS
RCLHSHAEALREKCINCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVP
DCCPGFFGMLCEPCPGGLGGVCSGHGQCQDRLLGSGECRCQEGFHGTACEMCELGRYGPT
CAGVCDCVHGLCQEGLRGDGSCVCNVGWQGLRCDQKITAPQCPKTCDSNANCVQSDGAVV
CVCAAGYTGNGSYCEVDPCAHDHGGCSPHANCTKVAPGQRICTCQDGYSGDGELCQETNS
CLVHHGGCHIHAECIPTGPQQVSCSCREGYSGDGIQACELLNPCSQNNGGCSPYAVCKSS
GDGQRTCTCDTAHTVGDGFTCRTRVGLELLRDKQALFFSLHLLEYEDLKGDGPFTIFVPH
ADLMTNLSKDDLAQIRAHRQLVFRYHVVGCRQLSSQELLDQGYATALSGHTLRFSEREGS
IYLNDFARVVSSDHEAVNGVLHFIDRVLLPPDVLHWEADATPTPRRNVTVAAESFGYKIF
SRLVTVAGLLPMLRDVSHRPLTMLWPTDSALQALPPDRQAWLYHEDHRDKLAAILRGHII
RNVEALASDLPNLGPLRTMHGTPISFSCSRARPGELMVGEDDAHIVQRHLPFEGGLAYGI
DQLLEPPGLGSRCDHFATQSLQMKTCSICGLELPCPVGSWEQGTPEACWRHYSRFWTTPL
LSSLALRSAWVRPSPWGQTPRLSRGCYRNCVTTVWKPRCCPGHYGSECQACPGGPSSPCS
SHGVCMDGMSGSGQCVCHSGFAGIACELCAPGAFGPQCQACRCGPHGHCDEGLGGSGSCW
CDEGWTGSRCEVQLELQPVCVPPCAPQAVCRGNNSCECSLGYEGDGRVCTVVDLCQHGHG
GCSEHANCSQVGTVVACVCLSDYEGDGWSCRARNPCLDGHRGGCSEHADCLNTGPNTRRC
ECHAGYVGDGLLCLEEPEPPVDRCLGHPSPCHADAVCTDLHFQEKKAGVFHLQASSGPYG
LTFSEAEVACGAQGAVLASLSQLSAAQQLGFHLCLVGWLANASAAHPVVFPAADCGDGRV
GVVSMGVRKNLSEHWDAYCYRVQDVTCRCQVGFVGDGISVCNGKLLDVLAATANFSTFYG
MLLGYANTTQRGLDFLDFLNDELTYKTLFVPVNEGFAHNMTLTGPDLELHASNATFLSAN
ASQGTLLPAHSGLSLFINDMGSDNSSWAPATPGAVVVSHVIFWDIMAFNGIIHVLASPLL
APLQPEAVLAPEAPSVAAGVGAVVAAGTLLGLVAGAFYLRTRGKPTGFSFSAFQAEDDAD
EDFSPWQEGPTSPTLVSVPNPIFGSHDAFCEPFDDSLLEDDFPDTQRILAVK
Download sequence
Identical sequences ENSDORP00000003583 ENSDORP00000003583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]