SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003629 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003629
Domain Number 1 Region: 295-480
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-67
Family SPRY domain 0.00000499
Further Details:      
 
Domain Number 2 Region: 8-84
Classification Level Classification E-value
Superfamily RING/U-box 5.74e-22
Family RING finger domain, C3HC4 0.0093
Further Details:      
 
Domain Number 3 Region: 88-153
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 9.92e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003629   Gene: ENSDORG00000003887   Transcript: ENSDORT00000003887
Sequence length 485
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_12459:27008:32158:-1 gene:ENSDORG00000003887 transcript:ENSDORT00000003887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKALVEAIVEEVACPICMTFLKDPMSIDCGHTFCHSCLSGLWKVPGESQNWGYTCPLC
RAPVQPKNLRPNWQLANVVEKVRQLGPCPEMGLKSDVCELHGEQLKMFCQEDGAMMCKSC
SQSPEHEAHSVLPMEDVAWEYKWKLHEALEHLRKEQEEAWKLEVSERKRTANWKXXXXXX
XQSIIWEFEKCQQLLEKNNLPVQYIEVEAVAALASLELEKEETEHKLELNHLKLIQQSQT
LWRMIVELEERSQRPARWMLQDIHEVLNRSKSWSLQRPEPVSLELRTNCCVLGLRKILKT
YAADVRLDPDTAYSRLIVSEDRKCVHYGDIQQKLPDNPERFYRYNIVLGSQCISSGRHYW
EVEVGNRSEWGLGVCKENVDRKEVVYLSPDYGFWVIRLRKGTEYRAGTNEYPLLSLPVPP
RRVGIFLDYEAHDISFYNVTDNCSHIFTFPRQPFSGRLLPYFSPCYSIGANNTAPLTICS
LDGED
Download sequence
Identical sequences ENSDORP00000003629 ENSDORP00000003629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]