SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003663 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003663
Domain Number 1 Region: 265-628
Classification Level Classification E-value
Superfamily SIS domain 4.45e-105
Family double-SIS domain 0.000000472
Further Details:      
 
Domain Number 2 Region: 12-72
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000000103
Family Class II glutamine amidotransferases 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003663
Domain Number - Region: 133-186,217-240
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000182
Family Class II glutamine amidotransferases 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003663   Gene: ENSDORG00000003922   Transcript: ENSDORT00000003922
Sequence length 628
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3715:112043:136012:-1 gene:ENSDORG00000003922 transcript:ENSDORT00000003922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAIDGSNHEVKERHIQLVKKKGKVKALDEELYXXXXXXXXXXXETHLGIGHTRWATHGVP
SAVNSHPQRSDKGNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXRVIQQLEGAFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQI
PILYRTLEDVLRVNVYMISIFVAVNPRAYTCAIIEHTNRVIFLEDDDIAAVADGKLSIHR
IKRSASDDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLL
GGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFR
DDVCFFISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVA
STKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLKSLPELIKEVLSLDEKIHDLALE
LYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALVDKQMPVIMVI
MKDPCFTKCQNALQQVTARQGRQIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPL
QLLSFHLAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences ENSDORP00000003663 ENSDORP00000003663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]