SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003706 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003706
Domain Number 1 Region: 13-319,423-458
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.89e-71
Family FAD-linked reductases, N-terminal domain 0.00000000032
Further Details:      
 
Domain Number 2 Region: 299-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.16e-35
Family L-aminoacid/polyamine oxidase 0.000000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003706   Gene: ENSDORG00000003971   Transcript: ENSDORT00000003971
Sequence length 525
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_3166:7121:69736:1 gene:ENSDORG00000003971 transcript:ENSDORT00000003971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANREKANLTGHMFDVVVIGGGISGLAAAKLLSKYDINVLVLEARDRVGGRTYTVRXXXX
XXXXVGGAYVGPTQNRILRLSKELGLETYKVNIRERLVQYVKGKSYPFRGAFPPVWNPIT
YLDYNNLWRTMDKMGKEIPADAPWDAPHAEEWDKMTMKDLFDKICWTKTAREFATLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSVSNGGQERKFVGGSGQVSERIMDLLGDRVKL
SRPVTYIDHSGENIIVETLNHEVYECKYIISAIPPTLTAKIHFKPELPSERNQLIQRLPM
GAIIKCMMYYREAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKAER
LTKLHKEIRKRKICELYAKVLESEEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATHWSGYMEGAVEAGERAAREXXXXXXKVPKDIWLQEPESKDV
PSFEITHTFLEKYLPSVPGLLKIIGLSSVASIWIVLYRLKLFPRF
Download sequence
Identical sequences ENSDORP00000003706 ENSDORP00000003706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]