SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003709 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003709
Domain Number 1 Region: 28-276
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.04e-56
Family Ankyrin repeat 0.00023
Further Details:      
 
Domain Number 2 Region: 334-377
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000785
Family SOCS box-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003709   Gene: ENSDORG00000003974   Transcript: ENSDORT00000003974
Sequence length 384
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3756:6034:16966:-1 gene:ENSDORG00000003974 transcript:ENSDORT00000003974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHSTADLLLESRTADSRWSSHQRGLWSLTYEEELTTPLHVAASRGYTEVLRLLLRRRARP
DSAPGGRTALHEACAAGHPACVHVLLVAGADPNAPDQEGKRPLHLCRGAGTLECVELLLK
FGARVDGQTEDEKETALHVAARLGHVEMAALLLRRGACPDARNAEGWTPLLAACDARGQS
PAEAEASASRCFQLCSLLLSAGADADAADQDKLRPLHLACRRGHSAVVELLLSHGVSANA
MDYGGHTALHCALQGPAAALAQSPEHMVRALLNHGAVRVWPGALPKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXEHRRFYSSLFALARQPRSLQHSRCALRSHLESCLPH
ALPHLPLPPRLLRYLQLEFEDVLY
Download sequence
Identical sequences ENSDORP00000003709 ENSDORP00000003709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]