SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003733 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003733
Domain Number 1 Region: 233-444
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.54e-70
Family Eukaryotic proteases 0.00000018
Further Details:      
 
Domain Number 2 Region: 42-80
Classification Level Classification E-value
Superfamily GLA-domain 0.00000000000000488
Family GLA-domain 0.00063
Further Details:      
 
Domain Number 3 Region: 139-186
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000242
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 4 Region: 106-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000554
Family EGF-type module 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003733   Gene: ENSDORG00000004000   Transcript: ENSDORT00000003999
Sequence length 444
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1984:6693:17740:1 gene:ENSDORG00000004000 transcript:ENSDORT00000003999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWQLTSLLLFVATWEISGMPASPDSVFSSSEHAHQVLRIQKRSNSFLEEVRPGNLERECM
EEVCDFEEANEIFQDVDKTXXXXXXXXXXXXXXXXXXXXXXXXXXSCEHGQCIDGMGGFS
CNCMEGWEGKFCQQEVLFSHCGVDNGGCAHYCQEEGDGRRCSCAPGYELDDDQRQCKPKV
SFPCGKLGKRVEKKRTNIKRDTXXXXXXXXXXXXXXXXXXXXXXXXXVILLDSKKKLACG
GVLIHTSWVLTAAHCMDESKKLTVRLGEYDLRRRDKWEVDIDIEEILVHPNYTRRTSDND
IALIHLAQPVTLSKTIVPICLPDIGLAERELTQAGQETVVTGWGYQNGREKDVKRNRTFI
LTFIKIPVAPRNECIEAMNSVVSENMLCAGILGDRRDACDGDSGGPMVALSRGTWFLVGL
VSWGEGCGLLNNYGVYTKVSRYLD
Download sequence
Identical sequences ENSDORP00000003733 ENSDORP00000003733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]