SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003741 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003741
Domain Number 1 Region: 112-180
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.03e-25
Family Fibrinogen C-terminal domain-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003741   Gene: ENSDORG00000004007   Transcript: ENSDORT00000004007
Sequence length 181
Comment pep:novel scaffold:dipOrd1:scaffold_14104:13015:18204:1 gene:ENSDORG00000004007 transcript:ENSDORT00000004007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELSRIAMAPTLLVLLFWALSIKDLTVQANDTCPETKVVGLESSNQLTILRGCPGLPGPPG
PKGEAGARGERGEQGLPGPPGKEGPPGPKGDPGEKGPRGEKGDPESSETCATGPRNCKEL
LTHNDLLTGWHTIYLPDCRPLSVLCDMDTDGGGWTVFQRRVDSSVDFYRDWAAYKQSFGS
Q
Download sequence
Identical sequences ENSDORP00000003741 ENSDORP00000003741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]