SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003760 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003760
Domain Number 1 Region: 140-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000914
Family EGF-type module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003760   Gene: ENSDORG00000004028   Transcript: ENSDORT00000004027
Sequence length 251
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_5209:21760:29815:1 gene:ENSDORG00000004028 transcript:ENSDORT00000004027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSSLPPQAPVVLWLLIHCSGHYAAGLDTNETSSGTGELFFHSADGLEVSSRRDMSLERE
ISPVSEKPSSSELSSGSDYDYSEEYDNEPQVSGYIVDDSVRVEQVVKPKKNKTESEKSSH
KPKRKKKGGKNGKNRRNKKKKNPCDAEFQNFCIHGECKYIENLDAVTCNCHHDYFGERCG
EKSMKTQSIVDSDLSKIALAAIAAFISAVSFTAIAVVITVQFRKRYAREYEGEAEERKKL
RQENGNSHALA
Download sequence
Identical sequences A0A1S3FHW3
ENSDORP00000003760 ENSDORP00000003760 XP_012875629.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]