SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003772 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003772
Domain Number 1 Region: 236-478
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.1e-56
Family Decarboxylase 0.000000551
Further Details:      
 
Domain Number 2 Region: 13-204
Classification Level Classification E-value
Superfamily PRTase-like 1.07e-43
Family Phosphoribosyltransferases (PRTases) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003772   Gene: ENSDORG00000004041   Transcript: ENSDORT00000004039
Sequence length 480
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1908:392:14754:1 gene:ENSDORG00000004041 transcript:ENSDORT00000004039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGSALDPLVADLYDVQAFKFGNFVLKSGLSSPVYIDLRGIVSRPRLLRQVADILFQT
AQNAGISFDTVCGVPYTALPLATVICSTNQIPMLIRRKETKDYGTKRLVEGTINPGETCL
IIEDVVTSGSSVLETVEVLQKEGLKVTDAIVLLDREQGGKDKLEAHGIRLHSVCTLSKML
EILEQKKKIDSEMVGRVKRFIQENVFLAANHNGFLTSVKETPKELSFGARAELPRTHPVA
SKLLQLMQKKETNLCLSADVSEATELLQLADSLGPSICMLKTHVDILDDFNLDVMKELTA
LAKRHEFLIFEDRKFADIGNTVKKQYEGGVFKIASWADLVNAHVVPGAGVVKGLQEVGLP
LQRGCLLIAEMSSAGSLATGNYTKAAVGMAEEYCEFVVGFISGSRVSMKPEFLHLTPGVQ
LQAGGDHLGQQYNSPQEVIGKRGSDVIIVGRGILSAANRMEAAEMYRKAAWEAYLNRLEN
Download sequence
Identical sequences A0A1S3FEG4
ENSDORP00000003772 XP_012874871.1.60039 ENSDORP00000003772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]