SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003778 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003778
Domain Number 1 Region: 133-375
Classification Level Classification E-value
Superfamily vWA-like 9.39e-62
Family Integrin A (or I) domain 0.000000091
Further Details:      
 
Domain Number 2 Region: 419-465
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000000173
Family Integrin domains 0.0011
Further Details:      
 
Domain Number 3 Region: 26-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000481
Family Plexin repeat 0.00069
Further Details:      
 
Domain Number 4 Region: 590-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000614
Family Integrin beta EGF-like domains 0.0026
Further Details:      
 
Domain Number 5 Region: 547-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Integrin beta EGF-like domains 0.013
Further Details:      
 
Domain Number 6 Region: 89-156
Classification Level Classification E-value
Superfamily Integrin domains 0.0000136
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 7 Region: 631-668
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000314
Family Integrin beta tail domain 0.0044
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000003778
Domain Number - Region: 516-547
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003778   Gene: ENSDORG00000004043   Transcript: ENSDORT00000004046
Sequence length 797
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1908:25320:107911:-1 gene:ENSDORG00000004043 transcript:ENSDORT00000004046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGLAPLYACFLGLCALVPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEYFGSPRSV
TSRCDLKANLIRNGCDGEIESPASSTHIRRSLPLSNKGSSTMGSDVIQMMPQEVALNLRP
GDQTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDSIRLGTKLAEEMRKLTSNFRVGXXX
XXXXXXXXXXXXXXXXXXXXXXXYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSR
NRDAPEGGFDAILQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQCL
NEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEILHG
DSKNIIQLIINAYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXA
SFEVSVEARSCPSRHTEHKFALRPVGFRDSLQVAVTYSCTCGCSAGLEPDSIRCSGNGTY
VCGLCECNPSHLGTRCECQEGENQSGYQNLCREAEGKPLCSGRGECSCNQCSCFESEFGR
IYGPFCECDSFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRAKDGQIC
SDRGHCICGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLRPGKPDNQSCQHLCK
DEVITWADTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGSAPNTVT
ILLAVVGSILLIGLALLAIWKLLVTIHDRREFAKFQSESSRARYEVALNPLYRKPISTHT
VDFTFNKFNKSYNGTVD
Download sequence
Identical sequences ENSDORP00000003778 ENSDORP00000003778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]