SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003793 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003793
Domain Number 1 Region: 478-815
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.39e-87
Family PDEase 0.000000443
Further Details:      
 
Domain Number 2 Region: 90-250
Classification Level Classification E-value
Superfamily GAF domain-like 1.73e-25
Family GAF domain 0.00067
Further Details:      
 
Domain Number 3 Region: 237-282,309-428
Classification Level Classification E-value
Superfamily GAF domain-like 3.92e-20
Family GAF domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003793   Gene: ENSDORG00000004060   Transcript: ENSDORT00000004061
Sequence length 843
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3196:75052:111606:1 gene:ENSDORG00000004060 transcript:ENSDORT00000004061 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDISQEAVEKYLQENPQFVKEYFNKKLQVEALGGHSETRGVAGQASMSSLQLTQVEESA
LCXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQADRCSMFLCRARNGIPEVARLLDITPTS
KFEDNLVARDREVVFPLDIGIVGWAAHTKKALNVPDVKKNSHFSDFMDKQTGYITRNMLA
SPIVVGKEVLAVVMAVNKVSASEFSTQDAEVFSKYLNFVSVILKLQHTSYLYSVESRRSQ
ILMWSANKVFEELTDVERQFHKALYTVRTYLNCERYSIGLLDMTKEKEFYDEWPVKLGEV
APYKGPKTPDGREITFYKIIDYILHGKEEIKVIPAPPSDHWTLISGLPTYVAENGFICNM
LNAPADEYFTFQKGPIDETGWVIKNVLSLPIVNKKEDIVGVATFYNRKDGKPFDEHDEHI
TETSTQGCSNTDTEKMKNRDVEMMHTKASDESIXXXXXXXXXXXXXXXXXXXXXXXEEEL
PDPRTTNLYEFHFSDFPITEHELVKCGLRLFFEIKVVEKFKVPVEVLTRWMYTVRKGYRS
VTYHNWRHGFNVGQTMFTLLMTGRLKRYYTDLEAFAMLAAAFCHDIDHRGTNNLYQMXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXSLNIFQNLNKRQFETVIHLFEVAIIATDLALYF
KKRTMFQKIVDACEQMKTEEDAIRYVSTDPTKKEIIMAMMMTACDLSAITKPWEVQSQVA
LLVANEFWEQGDLERTVLQQQPIPMMDRNKKDELPKLQVGFIDFVCTFVYKEFSRFHEEI
TPMLSGLQSNRVEWKSLADEYEAKVKVLEEEGKKEEEGNMVGKAAKDLGRGSDDKKSKTC
LML
Download sequence
Identical sequences ENSDORP00000003793 ENSDORP00000003793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]