SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003834 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003834
Domain Number 1 Region: 255-559
Classification Level Classification E-value
Superfamily Folate-binding domain 7.53e-70
Family Aminomethyltransferase folate-binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 561-654
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000000196
Family Aminomethyltransferase beta-barrel domain 0.0054
Further Details:      
 
Domain Number 3 Region: 57-131
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.0000000000208
Family L-aminoacid/polyamine oxidase 0.024
Further Details:      
 
Domain Number 4 Region: 1-55
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000081
Family FAD-linked reductases, N-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003834   Gene: ENSDORG00000004105   Transcript: ENSDORT00000004105
Sequence length 675
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_916:1810:26584:1 gene:ENSDORG00000004105 transcript:ENSDORT00000004105 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQIYDRTTILHVMVKKGQVTGVETDKGQIECQYFVNCAGQWAYELGLSNEEPVSIPLHAC
EHFYLLTRPLETPLQSTTPTIVDADGRIYIRNWQGGILSGGFEKNPKPIFTEGKNQLEIQ
NLQEDWDHFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLMYD
LKVPRWDFQTGRQLRTSLYDRLDAQGARWMEKHGFERPKYFVPPDKDLLALEQSKTFYKP
DWFDIVESEVKCCKEAVCVIDMSSFTKFEITSTGDQALEILQFLFSNDLDVPVGHIVHTG
MLNEGGGYENDCSIARLNKRXXXXXXXXXXXXXXXXXXXXYMPKDSNLLLEDVTWKYTAL
NLIGPRAVDVLSELSYAPMTPDHFPTLFCKEMSVGYANGIRVMSMTHTGEPGFMLYIPIE
YALHVYNEVMSVGQKYGIRNAGYYALRSLRIEKFFAFWGQDLNTLTTPLECGGESRVKLD
KDMDFIGRDALLHQKQNGVYKRLTMFILDDHDTDLDLWPWWGEPIYRNGQYVGKTTSSAY
SYTLERHVCLGFVHNFSEDSGEEQVVTADFINRGEYEIDIAGNRFQAKAKLYPVPSLFTH
KRRKDDMERSDLHGK
Download sequence
Identical sequences ENSDORP00000003834 ENSDORP00000003834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]