SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003839 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003839
Domain Number 1 Region: 6-258
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.39e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000429
Further Details:      
 
Domain Number 2 Region: 259-458
Classification Level Classification E-value
Superfamily Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 1.96e-59
Family Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) 0.000018
Further Details:      
 
Domain Number 3 Region: 595-758
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.57e-39
Family AlaX-like 0.035
Further Details:      
 
Domain Number 4 Region: 515-589
Classification Level Classification E-value
Superfamily Translation proteins 0.000000000000353
Family AlaX-M N-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003839   Gene: ENSDORG00000004110   Transcript: ENSDORT00000004111
Sequence length 966
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_916:53476:74077:-1 gene:ENSDORG00000004110 transcript:ENSDORT00000004111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPLTAREIRKRFIDFFQRNEHTYVHSSATIPLDDPTLLFANAGMNQFKPIFLNTIDPT
HPMAKLSRAANTQKCIRAGGKHNDLDDVGKDVYHHTFFEMLGSWSFGDYFKELACKMALE
LLTQEFGIPVERLYVTYFGGDEAAGLEPDLECKQIWQNLGLDDTKILPGNMKDNFWEMGD
TGPCGPCSEIHYDRIGGRDAAHLVNQDDPNVLEIWNLVFIQYNREMDGVLKPLPKKSIDT
GMGLERLVSVLQNKMSNYDTDLFVPYFEAIQKGTGARPYTGKVGAEDVDGIDMAYRVLAD
HARTITVALADGGRPDNTGRGYVLRRILRRAVRYSHEKLNASRGFFATLVDVVVQSLGDA
FPELKKDPDMVKDIINEEEVQFLKTLSRGRRILDRKIQSLGDCKTIPGDTAWLLYDTYEF
PVDLTGLIAEEKGLVVDMDGFEEERKLAQLKSQGKGAGGEDLIMLDIYAIEELRAKGLEA
TDDSPKYNYHSDSSGSYAFESTVATVLALCREKMFVEEVSTGQECGVVLDKTCFYAEQGG
QIYDCYLVVDDSSDDKTEFTVKNAQVRGGYVLHIGTIYGSLKVGDQVRLFLDEPRRRPVM
SNHTATHILNFALRSVLGEADQKGSLVAPDRLRFDFTAKGAMSTQQIKKAEEIANEMIEA
AKPVYTQDCPLAAAKAIQGLRAVFDETYPDPVRVVSIGVPVSDLLDDPSGPAGSLTSVEF
CGGTHLQNSSHAGAFVIVTEEAIAKGIRRIVAVTGAEAQKALRKADSLKKSLCVMEAKVK
AQTAPNKDVQREIADLGEALATAVIPQWQKDELRETLKSLKKVMDDLDRASKADVQKRVL
EKTKQLIDSNPNQPLVILEMESGASAKALNEALKLFKTHSPQTSAMLFTVDNEAGKITCL
CQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDVSAQATGKNVGCLQEALQLATSFAQLR
LGDVKN
Download sequence
Identical sequences ENSDORP00000003839 ENSDORP00000003839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]