SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000003932 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000003932
Domain Number 1 Region: 365-614
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.45e-82
Family Leukotriene A4 hydrolase catalytic domain 0.00039
Further Details:      
 
Domain Number 2 Region: 152-358
Classification Level Classification E-value
Superfamily Leukotriene A4 hydrolase N-terminal domain 6.54e-56
Family Leukotriene A4 hydrolase N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000003932   Gene: ENSDORG00000004208   Transcript: ENSDORT00000004208
Sequence length 1018
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1864:33511:78236:1 gene:ENSDORG00000004208 transcript:ENSDORT00000004208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGEHEMDEDE
EDYESSAKLLGMSFMNRSSGLRNSAAGYRQNTDGACSVPSTRTLVVCAFVIVVAVSVIMV
IYLLPRCTFTKEGCHKKNQSIGLIQPLATNGKLFPWAQIRLPTAVMPQRYELNLHPNLTS
MTFKGSVTISLQALQATWNVILHSTGHNISRVTFMSAVSNQEKQVELLEYPYHEQIAIVS
SEALLAGHNYTLKIEYSANISSSYYGFYGITYKDDSNEKKYFAATQFEPLAARSAFPCFD
EPAFKATFIIRIVREEQYTALSNMPKKSSVHMENGLVQDEFCESVKMSTYLIAFIVGEMK
NLSQDVNGTLVSIYVVPEKIGEVHHALETAVKLLQFFHDYFEIQYPLKKLDLVAIPDFEA
GAMENWGLLTFREETLLYDNSTSSVADRKLVTKIIAHELAHQWFGNLVTMQWWNDLWLNE
GFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQIEEMFDSL
SYFKGASLLLMLKTYLSEDVFQRAIILYLRNHSYGSIQSDDLWDSFNEVTNKTPDIKKMM
KTWTLQKGFPLVTVQRKGMELFIQQERFFLNMKHEIQPSDASYLWHIPISYVTDGRNYSK
YQSVSLLDKKSGVINLTEQVQWVKVNTNMTGYYIVHYADEDWAALIKQLKMSPYVLSDKD
RANLINNIFELAGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXTRVYNLLQTQTQQQTWTDDGTPSVRELRSVLLDFACTHNLGDCNTTAMKLFDDWM
ASNGNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLMNSCLHGDIFRTQKLSFIIRTVGQHFPGHLLAWDFVKENWNKLVQKFHLGSYTIQSIV
AGSTHLFATKTHLSEVKSFFESQSEATFQLHCVQEALEVIQLNIQWIEKNLGDLTWWL
Download sequence
Identical sequences ENSDORP00000003932 ENSDORP00000003932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]