SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004032 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004032
Domain Number 1 Region: 18-114
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 8.51e-30
Family Inhibitor of apoptosis (IAP) repeat 0.00000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004032   Gene: ENSDORG00000004314   Transcript: ENSDORT00000004314
Sequence length 140
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_890:11:3530:1 gene:ENSDORG00000004314 transcript:ENSDORT00000004314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLSLPMTCQLNSRDHRCTFKNSPSMRSCSRTPERMAEAGFIHCPTENEPDLAQCFFCL
KELEGWEPDDNPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIXXXXXXXX
XEFEAAEKVRNVIEQMGALE
Download sequence
Identical sequences ENSDORP00000004032 ENSDORP00000004032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]