SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004150 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004150
Domain Number 1 Region: 36-129
Classification Level Classification E-value
Superfamily MIR domain 3.01e-31
Family MIR domain 0.0000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004150   Gene: ENSDORG00000004438   Transcript: ENSDORT00000004438
Sequence length 221
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2538:2236:4942:1 gene:ENSDORG00000004438 transcript:ENSDORT00000004438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSAGRGGAAGLALLVLLLAFLVPGGGTSKTGAGLVTCGSVLKLLNTNHRVRLHSHDIKY
GSGSGQQSVTGVEASDDANSYWRIRGGSEGGCPRGLPVRCGQAVRLTHVLTGKNLHTHHF
PSPLSNNQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PIRGQLEVHGMPSANTHNTWKAMEGIFIKPGAEPSAGHDEL
Download sequence
Identical sequences ENSDORP00000004150 ENSDORP00000004150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]