SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004163 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004163
Domain Number 1 Region: 54-181,212-303
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.54e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.06
Further Details:      
 
Domain Number 2 Region: 620-710
Classification Level Classification E-value
Superfamily EF-hand 3.39e-17
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004163   Gene: ENSDORG00000004451   Transcript: ENSDORT00000004451
Sequence length 725
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1939:27366:182504:1 gene:ENSDORG00000004451 transcript:ENSDORT00000004451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFQKAVKGTVLVGGGALATILGLSQFAHYKRKQVNLAYVEAAEYVTELVNREPPSREAQ
LLTLKNTSEFDILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQNAIMNLDMEHYRMVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKMY
DLVAGSNCLKSSYVLSKSKALEHFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYMEVVRLLKKTDPQTGKERVSGARCKDVLTGQEFDVRAKCVINATGPFTDSVRKM
DDKNSPPICQASAGVHIVMPGYYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNEVRNYLSDEVRRGDVLAAWSGIRPLVTDPNSADTQSISRNHIV
DVSESGLITIAGGKWTTYRSMAEDTINAAIKVHNLKAGPSRTVGLFLQGGKDWSPTLYIR
LVQDYGLESEVAQHLSTTYGDKAFEVAKMASVTGKRWPIVGVRLVSEFPYIEAEVKYGIK
EYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGRELNWSDSKKQEELETAKKFLYYE
MGYKSRSEQLTDRSEICLLPSDIDRYKKRFHKFDADQKGFITIVDVQRVLENINVQMDEN
TLHEILNEVDLNKNGQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDQRVPIPVDR
SGGGL
Download sequence
Identical sequences ENSDORP00000004163 ENSDORP00000004163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]