SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004243 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004243
Domain Number 1 Region: 106-241
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.28e-32
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004243   Gene: ENSDORG00000004532   Transcript: ENSDORT00000004533
Sequence length 485
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_13349:3529:9496:1 gene:ENSDORG00000004532 transcript:ENSDORT00000004533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEASAAGPRVLGWVCLRAGRGLTRHVSLPKAHVERSNSTSQQRSPGRPPGPAPLTPPRAA
LSPGELSDYHTFGKYSELFAAAVGNVEWLRFCINPDRQEILADDKGFTAIHLAAQRARLS
CIQVLVEEYKFPVDLPTDDCRTPLHLVIHKDNKTMAVPCIDYLLQKGAAINSVTLNRSTP
LHLAACDGMLTCMKVLVQNGADVHARDATGCKPIDYCKIWNHRSCARFLKDAMWKHDKKD
FAREMEKLKHLKNKLISMEQNYLIKHQKEQSIQRDTEFSKWLHSKKQCQPLISSSTQEAR
ATALSTTSEKGVRRTVEARLQSLLLQPKMLPKPLNPFLIHQRPKSWNRSSNPATPPATDI
SCPQGIRLGVHPDPHREHDFSSFLEVIQDAHGLMSLHTVDGHWVAPLPQLPFKVIVDSLF
PKSQPYRMKVPEGLYPISVLNLTQKRQVGQDTWIDGVTMNLRETFDEAFLLALQAQMLPS
PPQSS
Download sequence
Identical sequences ENSDORP00000004243 ENSDORP00000004243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]