SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000004255 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000004255
Domain Number 1 Region: 156-274
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-33
Family C-type lectin domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000004255   Gene: ENSDORG00000004545   Transcript: ENSDORT00000004545
Sequence length 277
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4804:243542:279638:1 gene:ENSDORG00000004545 transcript:ENSDORT00000004545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAFGVLLRSNQFILLLLFLLQIQSLGLDIDSRPTPEVCTTPTISPGPKGDDGEKGDPGE
EGKDGKVGRKGPKGLKGELGDRGDQGSIGKSGPMGQKGDKGEKGLLGMRGGKGKAXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXIAGIRETEEKFYYIVQEEKNYRESLTHCRIRG
GMLAMPKDETVNNLIADYVSKSGFFRVFIGVNDLEREGQFVFTDNTPLQNYSNWKDGEPS
DPYGQEDCVEMLSSGRWNDTGCHLTMYFVCEFVKKKK
Download sequence
Identical sequences ENSDORP00000004255 ENSDORP00000004255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]